SCOPe 2.08: Domain d2d00d2: 2d00 D:6-109

Lineage for d2d00d2 (2d00 D:6-109)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.149: AtpF-like [159467] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.149.1: AtpF-like [159468] (2 families)
   automatically mapped to Pfam PF01990

5. Family c.149.1.1: AtpF-like [159469] (2 proteins)
   Pfam PF01990; segment-swapping in some members

6. Protein automated matches [190584] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187591] (1 PDB entry)

8. Domain d2d00d2: 2d00 D:6-109 [146444]
   Other proteins in same PDB: d2d00a1, d2d00a2, d2d00b3, d2d00c3, d2d00d3, d2d00e3, d2d00f3
   automated match to d2d00a1
   complexed with ca

Details for d2d00d2

PDB Entry: 2d00, 2.2 Å

PDB Description: Subunit F of V-type ATPase/synthase

PDB Compounds: (D:) V-type ATP synthase subunit F

SCOPe Domain Sequences for d2d00d2:

Sequence; same for both SEQRES and ATOM records:

>d2d00d2 c.149.1.1 (D:6-109) automated matches {Thermus thermophilus [TaxId: 274]}
maviadpetaqgfrlaglegygassaeeaqslletlverggyalvavdeallpdperave
rlmrgrdlpvllpiaglkeafqghdvegymrelvrktigfdikl

Timeline for d2d00d2:

• d2d00d2 first appeared in SCOP 1.75, called d2d00d1
  
• d2d00d2 appears in SCOPe 2.07