Lineage for d2d00c2 (2d00 C:6-109)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2170640Fold c.149: AtpF-like [159467] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2170641Superfamily c.149.1: AtpF-like [159468] (1 family) (S)
    automatically mapped to Pfam PF01990
  5. 2170642Family c.149.1.1: AtpF-like [159469] (2 proteins)
    Pfam PF01990; segment-swapping in some members
  6. 2170654Protein automated matches [190584] (2 species)
    not a true protein
  7. 2170658Species Thermus thermophilus [TaxId:274] [187591] (1 PDB entry)
  8. 2170660Domain d2d00c2: 2d00 C:6-109 [146443]
    Other proteins in same PDB: d2d00a1, d2d00a2, d2d00b3, d2d00c3, d2d00d3, d2d00e3, d2d00f3
    automated match to d2d00a1
    complexed with ca

Details for d2d00c2

PDB Entry: 2d00 (more details), 2.2 Å

PDB Description: Subunit F of V-type ATPase/synthase
PDB Compounds: (C:) V-type ATP synthase subunit F

SCOPe Domain Sequences for d2d00c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d00c2 c.149.1.1 (C:6-109) automated matches {Thermus thermophilus [TaxId: 274]}
maviadpetaqgfrlaglegygassaeeaqslletlverggyalvavdeallpdperave
rlmrgrdlpvllpiaglkeafqghdvegymrelvrktigfdikl

SCOPe Domain Coordinates for d2d00c2:

Click to download the PDB-style file with coordinates for d2d00c2.
(The format of our PDB-style files is described here.)

Timeline for d2d00c2: