SCOPe 2.08: Domain d2czra1: 2czr A:1-218

Lineage for d2czra1 (2czr A:1-218)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.4: TBP-interacting protein-like [159612] (1 family)
   contains extra C-terminal alpha+beta domain of complex fold with an embeded C2H2 zinc-finger

5. Family c.52.4.1: TBP-interacting protein-like [159613] (1 protein)
   PfamB PB059845 (N-terminal domain) and Pfam B059846 (C-terminal region)

6. Protein TBP-interacting protein [159614] (1 species)

7. Species Thermococcus kodakaraensis [TaxId:311400] [159615] (1 PDB entry)
   Uniprot Q9V2W6 1-218
   TK1172

8. Domain d2czra1: 2czr A:1-218 [146440]
   Other proteins in same PDB: d2czra2
   complexed with gol, zn

Details for d2czra1

PDB Entry: 2czr, 2.3 Å

PDB Description: Crystal structure of TBP-interacting protein (Tk-TIP26) and implications for its inhibition mechanism of the interaction between TBP and TATA-DNA

PDB Compounds: (A:) TBP-interacting protein

SCOPe Domain Sequences for d2czra1:

Sequence; same for both SEQRES and ATOM records:

>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]}
myaelspgtkkvytqvrylddyhweiegstitgihkksnvkvvidvaknreeadslagkd
vngihivaipdngvfyikngsfvltyrylkatladindhivwsgfkvvedngklvqedvy
eylgaalvnhiknnalagqdyifwqfykceecgkyvdienleahlrehgiklhekseehy
evfelnfregkvfdkfggevpmdkfssearefikevls

Timeline for d2czra1:

• d2czra1 first appeared in SCOP 1.75
  
• d2czra1 appears in SCOPe 2.07