Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
Protein Uncharacterized protein TTHA1431 [159869] (1 species) |
Species Thermus thermophilus [TaxId:274] [159870] (3 PDB entries) Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68 |
Domain d2cz8a1: 2cz8 A:2-68 [146432] Other proteins in same PDB: d2cz8b_, d2cz8c_, d2cz8d_, d2cz8e_, d2cz8f_, d2cz8g_, d2cz8h_ complexed with fad, k, po4 |
PDB Entry: 2cz8 (more details), 1.5 Å
SCOPe Domain Sequences for d2cz8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz8a1 d.230.2.1 (A:2-68) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]} gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle vgfrlee
Timeline for d2cz8a1: