Lineage for d2cy7a_ (2cy7 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155379Family d.3.1.22: Autophagin-like [159858] (3 protein domains)
    Pfam PF03416
  6. 2155391Protein automated matches [190846] (1 species)
    not a true protein
  7. 2155392Species Human (Homo sapiens) [TaxId:9606] [188165] (3 PDB entries)
  8. 2155394Domain d2cy7a_: 2cy7 A: [146431]
    automated match to d2cy7a1

Details for d2cy7a_

PDB Entry: 2cy7 (more details), 1.9 Å

PDB Description: The crystal structure of human Atg4B
PDB Compounds: (A:) Cysteine protease APG4B

SCOPe Domain Sequences for d2cy7a_:

Sequence, based on SEQRES records: (download)

>d2cy7a_ d.3.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt
gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys
ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr
tsvpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdineayvetlk
hcfmmpqslgviggkpnsahyfigyvgeeliyldphttqpaveptdgcfipdesfhcqhp
pcrmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveqqpshlacpdv
lnlsldssdverl

Sequence, based on observed residues (ATOM records): (download)

>d2cy7a_ d.3.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt
gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys
ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr
tsvpcspwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvg
eeliyldphttqpavegcfipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcq
qvkklsllpmfelveqqpdvlnlsldssdverl

SCOPe Domain Coordinates for d2cy7a_:

Click to download the PDB-style file with coordinates for d2cy7a_.
(The format of our PDB-style files is described here.)

Timeline for d2cy7a_: