Lineage for d2cu3b_ (2cu3 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179103Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 2179122Family d.15.3.2: ThiS [54289] (5 proteins)
  6. 2179139Protein Uncharacterised protein TTHA0675 [159929] (1 species)
    probable ThiS homologue
  7. 2179140Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
    Uniprot Q5SKG8 1-63
  8. 2179142Domain d2cu3b_: 2cu3 B: [146429]
    automated match to d2cu3a1
    complexed with cd

Details for d2cu3b_

PDB Entry: 2cu3 (more details), 1.7 Å

PDB Description: Crystal structure of TT1568 from Thermus thermophilus HB8
PDB Compounds: (B:) unknown function protein

SCOPe Domain Sequences for d2cu3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cu3b_ d.15.3.2 (B:) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqgg

SCOPe Domain Coordinates for d2cu3b_:

Click to download the PDB-style file with coordinates for d2cu3b_.
(The format of our PDB-style files is described here.)

Timeline for d2cu3b_: