Lineage for d2cu2a2 (2cu2 A:1-268)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868897Family c.68.1.20: mannose-1-phosphate guanylyl transferase [159720] (1 protein)
    automatically mapped to Pfam PF00483
  6. 1868898Protein Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 [159721] (1 species)
  7. 1868899Species Thermus thermophilus [TaxId:274] [159722] (1 PDB entry)
    Uniprot Q5SHI0 1-268
  8. 1868900Domain d2cu2a2: 2cu2 A:1-268 [146427]
    Other proteins in same PDB: d2cu2a1
    complexed with so4

Details for d2cu2a2

PDB Entry: 2cu2 (more details), 2.2 Å

PDB Description: Crystal structure of mannose-1-phosphate geranyltransferase from Thermus thermophilus HB8
PDB Compounds: (A:) putative mannose-1-phosphate guanylyl transferase

SCOPe Domain Sequences for d2cu2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]}
mktyalvmaggrgerlwplsredrpkpflplfegktlleatlerlaplvppertllavrr
dqeavarpyadgirllleplgrdtagavllgvaealkegaerllvlpadhyvgddeayre
alatmleaaeegfvvalglrptrpeteygyirlgpregawyrgegfvekpsyaealeyir
kgyvwnggvfafapatmaelfrrhlpshhealerllagasleevyaglpkisidygvmek
aervrvvlgrfpwddvgnwralervfsq

SCOPe Domain Coordinates for d2cu2a2:

Click to download the PDB-style file with coordinates for d2cu2a2.
(The format of our PDB-style files is described here.)

Timeline for d2cu2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cu2a1