Lineage for d2cu0a1 (2cu0 A:3-96,A:207-480)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080675Species Pyrococcus horikoshii [TaxId:53953] [159379] (1 PDB entry)
    Uniprot O58045 3-96,207-480
  8. 2080676Domain d2cu0a1: 2cu0 A:3-96,A:207-480 [146425]
    disordered CBS domain is cut out
    complexed with xmp

Details for d2cu0a1

PDB Entry: 2cu0 (more details), 2.1 Å

PDB Description: Crystal structure of inosine-5'-monophosphate dehydrogenase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d2cu0a1:

Sequence, based on SEQRES records: (download)

>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]}
kfveklekaikgytfddvllipqatevepkdvdvstritpnvklnipilsaamdtvtewe
mavamaregglgvihrnmgieeqveqvkrvkraeXkyknavrdengellvaaavspfdik
raieldkagvdvivvdtahahnlkaiksmkemrqkvdadfivgnianpkavddltfadav
kvgigpgsicttrivagvgvpqitavamvadraqeyglyviadggirysgdivkaiaaga
davmlgnllagtkeapgkeviingrkykqyrgmgslgammkggaeryyqggymktrkfvp
egvegvvpyrgtvsevlyqlvgglkagmgyvgarnirelkekgefviithagikeshphd
iiitneapn

Sequence, based on observed residues (ATOM records): (download)

>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]}
kfveklekaikgytfddvllipqatevepkdvdvstritpnvklnipilsaamdtvtewe
mavamaregglgvihrnmgieeqveqvkrvkraeXkyknavrdengellvaaavspfdik
raieldkagvdvivvdtahahnlkaiksmkemrqkvdadfivgnianpkavddltfadav
kvgigpgsicttrivagvgvpqitavamvadraqeyglyviadggirysgdivkaiaaga
davmlgnllagtkeapgkeviingrkykqyrgmgslgammkymktrkfvpegvegvvpyr
gtvsevlyqlvgglkagmgyvgarnirelkekgefviithagikeshphdiiitneapn

SCOPe Domain Coordinates for d2cu0a1:

Click to download the PDB-style file with coordinates for d2cu0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cu0a1: