Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Kin of IRRE-like protein 3, KIRREL3 [158867] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158868] (1 PDB entry) Uniprot Q8IZU9 413-521 |
Domain d2crya1: 2cry A:8-122 [146423] |
PDB Entry: 2cry (more details)
SCOPe Domain Sequences for d2crya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} tltvngppiisstqtqhalhgekgqikcfirstpppdriawswkenvlesgtsgrytvet isteegvistltisnivradfqtiynctawnsfgsdteiirlkeqgsemsgpssg
Timeline for d2crya1: