Lineage for d2crya1 (2cry A:8-122)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757680Protein Kin of IRRE-like protein 3, KIRREL3 [158867] (1 species)
  7. 1757681Species Human (Homo sapiens) [TaxId:9606] [158868] (1 PDB entry)
    Uniprot Q8IZU9 413-521
  8. 1757682Domain d2crya1: 2cry A:8-122 [146423]

Details for d2crya1

PDB Entry: 2cry (more details)

PDB Description: solution structure of the fifth ig-like domain of human kin of irre like 3
PDB Compounds: (A:) Kin of IRRE-like protein 3

SCOPe Domain Sequences for d2crya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]}
tltvngppiisstqtqhalhgekgqikcfirstpppdriawswkenvlesgtsgrytvet
isteegvistltisnivradfqtiynctawnsfgsdteiirlkeqgsemsgpssg

SCOPe Domain Coordinates for d2crya1:

Click to download the PDB-style file with coordinates for d2crya1.
(The format of our PDB-style files is described here.)

Timeline for d2crya1: