Lineage for d2cqma1 (2cqm A:28-136)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050126Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 1050127Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 1050128Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 1050129Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 1050165Species Human (Homo sapiens) [TaxId:9606] [160269] (1 PDB entry)
    Uniprot Q9NRX2 28-136
  8. 1050166Domain d2cqma1: 2cqm A:28-136 [146422]

Details for d2cqma1

PDB Entry: 2cqm (more details)

PDB Description: Solution structure of the mitochondrial ribosomal protein L17 isolog
PDB Compounds: (A:) Ribosomal protein L17 isolog

SCOPe Domain Sequences for d2cqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqma1 d.188.1.1 (A:28-136) Prokaryotic ribosomal protein L17 {Human (Homo sapiens) [TaxId: 9606]}
llrnlltglvrherieapwarvdemrgyaeklidygklgdtneramrmadfwltekdlip
klfqvlaprykdqtggytrmlqipnrsldrakmavieykgnclpplplp

SCOPe Domain Coordinates for d2cqma1:

Click to download the PDB-style file with coordinates for d2cqma1.
(The format of our PDB-style files is described here.)

Timeline for d2cqma1: