Lineage for d2colb_ (2col B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711204Species African clawed frog (Xenopus laevis) [TaxId:8355] [225045] (1 PDB entry)
  8. 2711205Domain d2colb_: 2col B: [146420]
    automated match to d1cmga_
    complexed with ca, mg, pop

Details for d2colb_

PDB Entry: 2col (more details), 2.2 Å

PDB Description: Crystal structure analysis of CyaA/C-Cam with Pyrophosphate
PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d2colb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2colb_ a.39.1.5 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
tdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny
eefvqmm

SCOPe Domain Coordinates for d2colb_:

Click to download the PDB-style file with coordinates for d2colb_.
(The format of our PDB-style files is described here.)

Timeline for d2colb_: