![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.48: F93-like [109674] (4 proteins) contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers |
![]() | Protein STIV F93 [158292] (1 species) different dimerization mode than SSV1 F93 |
![]() | Species Sulfolobus turreted icosahedral virus [TaxId:269145] [158293] (1 PDB entry) Uniprot Q6Q0J9 5-93 |
![]() | Domain d2co5a1: 2co5 A:5-93 [146418] Other proteins in same PDB: d2co5a2, d2co5b2, d2co5b3 protein/DNA complex |
PDB Entry: 2co5 (more details), 2.2 Å
SCOPe Domain Sequences for d2co5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co5a1 a.4.5.48 (A:5-93) STIV F93 {Sulfolobus turreted icosahedral virus [TaxId: 269145]} kymrinyyiilkvlvingsrlekkrlrseilkrfdidisdgvlyplidsliddkilreee apdgkvlfltekgmkefeelheffkkivc
Timeline for d2co5a1: