Lineage for d2cmua1 (2cmu A:3-332)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872041Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 872042Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 872110Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 872137Protein Putative peptidyl-arginine deiminase [111158] (3 species)
  7. 872140Species Helicobacter pylori J99 [TaxId:85963] [111159] (1 PDB entry)
    Uniprot Q9ZN18
  8. 872141Domain d2cmua1: 2cmu A:3-332 [146414]

Details for d2cmua1

PDB Entry: 2cmu (more details), 2.5 Å

PDB Description: crystal structure of a putative peptidyl-arginine deiminase
PDB Compounds: (A:) putative peptidyl-arginine deiminase

SCOP Domain Sequences for d2cmua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmua1 d.126.1.6 (A:3-332) Putative peptidyl-arginine deiminase {Helicobacter pylori J99 [TaxId: 85963]}
lkrmlaefekiqailmafphefsdwaycikearesflniiqtiakhakvlvcvhtndtig
yemlknlpgveiakvdtndtwardfgaisienhgvlecldfgfngwglkypsnldnqvnf
klkslgflkhplktmpyvleggsiesdgagsiltntqclleknrnphlnqngietmlkke
lgakqvlwysygylkgddtdshtdtlarfldkdtivysacedkndehytalkkmqeelkt
fkkldktpyklipleipkaifdenqqrlpatyvnfllcndalivptyndpkdaliletlk
qhtplevigvdcntlikqhgslhcvtmqly

SCOP Domain Coordinates for d2cmua1:

Click to download the PDB-style file with coordinates for d2cmua1.
(The format of our PDB-style files is described here.)

Timeline for d2cmua1: