Lineage for d2cmua1 (2cmu A:3-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974383Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2974399Protein Putative peptidyl-arginine deiminase [111158] (3 species)
  7. 2974402Species Helicobacter pylori J99 [TaxId:85963] [111159] (2 PDB entries)
    Uniprot Q9ZN18
  8. 2974404Domain d2cmua1: 2cmu A:3-332 [146414]
    Other proteins in same PDB: d2cmua2

Details for d2cmua1

PDB Entry: 2cmu (more details), 2.5 Å

PDB Description: crystal structure of a putative peptidyl-arginine deiminase
PDB Compounds: (A:) putative peptidyl-arginine deiminase

SCOPe Domain Sequences for d2cmua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmua1 d.126.1.6 (A:3-332) Putative peptidyl-arginine deiminase {Helicobacter pylori J99 [TaxId: 85963]}
lkrmlaefekiqailmafphefsdwaycikearesflniiqtiakhakvlvcvhtndtig
yemlknlpgveiakvdtndtwardfgaisienhgvlecldfgfngwglkypsnldnqvnf
klkslgflkhplktmpyvleggsiesdgagsiltntqclleknrnphlnqngietmlkke
lgakqvlwysygylkgddtdshtdtlarfldkdtivysacedkndehytalkkmqeelkt
fkkldktpyklipleipkaifdenqqrlpatyvnfllcndalivptyndpkdaliletlk
qhtplevigvdcntlikqhgslhcvtmqly

SCOPe Domain Coordinates for d2cmua1:

Click to download the PDB-style file with coordinates for d2cmua1.
(The format of our PDB-style files is described here.)

Timeline for d2cmua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cmua2