Lineage for d2ckdb_ (2ckd B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894357Family c.66.1.57: ML2640-like [159694] (2 proteins)
    Pfam PF02409; O-methyltransferase N-terminus (DUF142); most similar structure to the Leucine carboxy methyltransferase Ppm1 family
  6. 2894361Protein automated matches [190566] (1 species)
    not a true protein
  7. 2894362Species Mycobacterium leprae [TaxId:1769] [187556] (3 PDB entries)
  8. 2894365Domain d2ckdb_: 2ckd B: [146410]
    Other proteins in same PDB: d2ckda1
    automated match to d2ckda1

Details for d2ckdb_

PDB Entry: 2ckd (more details), 2.8 Å

PDB Description: crystal structure of ml2640 from mycobacterium leprae
PDB Compounds: (B:) putative s-adenosyl-l-methionine-dependent methyltransferase ml2640

SCOPe Domain Sequences for d2ckdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckdb_ c.66.1.57 (B:) automated matches {Mycobacterium leprae [TaxId: 1769]}
svgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldpsmvakveaidae
aaamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrldwptgttvyeid
qpkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsartawlaegllmyl
pataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsdalgfeqavdvqel
iyhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkdafaefvtahrl

SCOPe Domain Coordinates for d2ckdb_:

Click to download the PDB-style file with coordinates for d2ckdb_.
(The format of our PDB-style files is described here.)

Timeline for d2ckdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ckda1