![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.57: ML2640-like [159694] (2 proteins) Pfam PF02409; O-methyltransferase N-terminus (DUF142); most similar structure to the Leucine carboxy methyltransferase Ppm1 family |
![]() | Protein automated matches [190566] (1 species) not a true protein |
![]() | Species Mycobacterium leprae [TaxId:1769] [187556] (3 PDB entries) |
![]() | Domain d2ckdb_: 2ckd B: [146410] Other proteins in same PDB: d2ckda1 automated match to d2ckda1 |
PDB Entry: 2ckd (more details), 2.8 Å
SCOPe Domain Sequences for d2ckdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckdb_ c.66.1.57 (B:) automated matches {Mycobacterium leprae [TaxId: 1769]} svgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldpsmvakveaidae aaamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrldwptgttvyeid qpkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsartawlaegllmyl pataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsdalgfeqavdvqel iyhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkdafaefvtahrl
Timeline for d2ckdb_: