Lineage for d2ckca1 (2ckc A:2563-2622)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958413Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958430Superfamily d.76.2: BRK domain-like [160481] (1 family) (S)
  5. 2958431Family d.76.2.1: BRK domain-like [160482] (2 proteins)
    Pfam PF07533; TCH domain
  6. 2958432Protein Chromodomain-helicase-DNA-binding protein 7, CHD7 [160485] (1 species)
  7. 2958433Species Human (Homo sapiens) [TaxId:9606] [160486] (3 PDB entries)
    Uniprot Q9P2D1 1799-1852! Uniprot Q9P2D1 1801-1860! Uniprot Q9P2D1 1869-1953
  8. 2958434Domain d2ckca1: 2ckc A:2563-2622 [146408]

Details for d2ckca1

PDB Entry: 2ckc (more details)

PDB Description: solution structures of the brk domains of the human chromo helicase domain 7 and 8, reveals structural similarity with gyf domain suggesting a role in protein interaction
PDB Compounds: (A:) chromodomain-helicase-DNA-binding protein 7

SCOPe Domain Sequences for d2ckca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckca1 d.76.2.1 (A:2563-2622) Chromodomain-helicase-DNA-binding protein 7, CHD7 {Human (Homo sapiens) [TaxId: 9606]}
ldpdtripvinledgtrlvgedapknkdlvewlklhptytvdmpsyvpknadvlfssfqk

SCOPe Domain Coordinates for d2ckca1:

Click to download the PDB-style file with coordinates for d2ckca1.
(The format of our PDB-style files is described here.)

Timeline for d2ckca1: