Lineage for d2ckaa1 (2cka A:2028-2085)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958413Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958430Superfamily d.76.2: BRK domain-like [160481] (1 family) (S)
  5. 2958431Family d.76.2.1: BRK domain-like [160482] (2 proteins)
    Pfam PF07533; TCH domain
  6. 2958437Protein Chromodomain-helicase-dna-binding protein 8, CHD8 [160483] (1 species)
  7. 2958438Species Human (Homo sapiens) [TaxId:9606] [160484] (2 PDB entries)
    Uniprot Q9HCK8 2024-2093! Uniprot Q9HCK8 2028-2085
  8. 2958439Domain d2ckaa1: 2cka A:2028-2085 [146407]

Details for d2ckaa1

PDB Entry: 2cka (more details)

PDB Description: solution structures of the brk domains of the human chromo helicase domain 7 and 8, reveals structural similarity with gyf domain suggesting a role in protein interaction
PDB Compounds: (A:) chromodomain-helicase-DNA-binding protein 8

SCOPe Domain Sequences for d2ckaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckaa1 d.76.2.1 (A:2028-2085) Chromodomain-helicase-dna-binding protein 8, CHD8 {Human (Homo sapiens) [TaxId: 9606]}
ldvdletripvinkvdgtllvgedaprraelemwlqghpefavdprflaymedrrkqk

SCOPe Domain Coordinates for d2ckaa1:

Click to download the PDB-style file with coordinates for d2ckaa1.
(The format of our PDB-style files is described here.)

Timeline for d2ckaa1: