![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily) dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta |
![]() | Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families) ![]() |
![]() | Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins) C-terminal part of Pfam PF00937 |
![]() | Protein automated matches [190565] (1 species) not a true protein |
![]() | Species Sars coronavirus [TaxId:229993] [187553] (1 PDB entry) |
![]() | Domain d2cjrh_: 2cjr H: [146406] Other proteins in same PDB: d2cjra1 automated match to d2cjra1 |
PDB Entry: 2cjr (more details), 2.5 Å
SCOPe Domain Sequences for d2cjrh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjrh_ d.254.1.2 (H:) automated matches {Sars coronavirus [TaxId: 229993]} skkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaf fgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidayktfp
Timeline for d2cjrh_: