Lineage for d2cjrg_ (2cjr G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052226Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 1052227Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families) (S)
  5. 1052238Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
    C-terminal part of Pfam PF00937
  6. 1052259Protein automated matches [190565] (1 species)
    not a true protein
  7. 1052260Species Sars coronavirus [TaxId:229993] [187553] (1 PDB entry)
  8. 1052266Domain d2cjrg_: 2cjr G: [146405]
    Other proteins in same PDB: d2cjra1
    automated match to d2cjra1

Details for d2cjrg_

PDB Entry: 2cjr (more details), 2.5 Å

PDB Description: crystal structure of oligomerization domain of sars coronavirus nucleocapsid protein.
PDB Compounds: (G:) nucleocapsid protein

SCOPe Domain Sequences for d2cjrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjrg_ d.254.1.2 (G:) automated matches {Sars coronavirus [TaxId: 229993]}
askkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasa
ffgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidaykt

SCOPe Domain Coordinates for d2cjrg_:

Click to download the PDB-style file with coordinates for d2cjrg_.
(The format of our PDB-style files is described here.)

Timeline for d2cjrg_: