SCOPe 2.01: Domain d2cjrf_: 2cjr F:

Lineage for d2cjrf_ (2cjr F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
   dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta

4. Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families)

5. Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
   C-terminal part of Pfam PF00937

6. Protein automated matches [190565] (1 species)
   not a true protein

7. Species Sars coronavirus [TaxId:229993] [187553] (1 PDB entry)

8. Domain d2cjrf_: 2cjr F: [146404]
   Other proteins in same PDB: d2cjra1
   automated match to d2cjra1

Details for d2cjrf_

PDB Entry: 2cjr, 2.5 Å

PDB Description: crystal structure of oligomerization domain of sars coronavirus nucleocapsid protein.

PDB Compounds: (F:) nucleocapsid protein

SCOPe Domain Sequences for d2cjrf_:

Sequence; same for both SEQRES and ATOM records:

>d2cjrf_ d.254.1.2 (F:) automated matches {Sars coronavirus [TaxId: 229993]}
aaeaskkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfaps
asaffgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidaykt

Timeline for d2cjrf_:

• d2cjrf_ first appeared in SCOP 1.75, called d2cjrf1
  
• d2cjrf_ appears in SCOPe 2.02
  
• d2cjrf_ appears in the current release, SCOPe 2.08