Lineage for d2cjrf_ (2cjr F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008871Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 3008872Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) (S)
  5. 3008883Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
    C-terminal part of Pfam PF00937
  6. 3008902Protein automated matches [190565] (3 species)
    not a true protein
  7. 3008906Species Sars coronavirus [TaxId:229993] [187553] (1 PDB entry)
  8. 3008911Domain d2cjrf_: 2cjr F: [146404]
    Other proteins in same PDB: d2cjra1
    automated match to d2cjra1

Details for d2cjrf_

PDB Entry: 2cjr (more details), 2.5 Å

PDB Description: crystal structure of oligomerization domain of sars coronavirus nucleocapsid protein.
PDB Compounds: (F:) nucleocapsid protein

SCOPe Domain Sequences for d2cjrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjrf_ d.254.1.2 (F:) automated matches {Sars coronavirus [TaxId: 229993]}
aaeaskkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfaps
asaffgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidaykt

SCOPe Domain Coordinates for d2cjrf_:

Click to download the PDB-style file with coordinates for d2cjrf_.
(The format of our PDB-style files is described here.)

Timeline for d2cjrf_: