SCOP 1.75: Domain d2cjrd1: 2cjr D:251-365

Lineage for d2cjrd1 (2cjr D:251-365)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
   dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta

4. Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families)

5. Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (1 protein)
   C-terminal part of Pfam PF00937

6. Protein Coronavirus nucleocapsid protein [143509] (2 species)

7. Species SARS coronavirus [TaxId:227859] [143511] (3 PDB entries)
   Uniprot P59595 270-366

8. Domain d2cjrd1: 2cjr D:251-365 [146402]
   automatically matched to 2CJR A:251-365

Details for d2cjrd1

PDB Entry: 2cjr, 2.5 Å

PDB Description: crystal structure of oligomerization domain of sars coronavirus nucleocapsid protein.

PDB Compounds: (D:) nucleocapsid protein

SCOP Domain Sequences for d2cjrd1:

Sequence; same for both SEQRES and ATOM records:

>d2cjrd1 d.254.1.2 (D:251-365) Coronavirus nucleocapsid protein {SARS coronavirus [TaxId: 227859]}
saaeaskkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfap
sasaffgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidayktfp

Timeline for d2cjrd1:

• d2cjrd1 is new in SCOP 1.75
  
• d2cjrd1 is called d2cjrd_ in SCOPe 2.01
  
• d2cjrd1 appears in the current release, SCOPe 2.08, called d2cjrd_