Lineage for d2ciba_ (2cib A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005494Species Mycobacterium tuberculosis [TaxId:83332] [187210] (6 PDB entries)
  8. 2005496Domain d2ciba_: 2cib A: [146398]
    automated match to d1e9xa_
    complexed with cm6, hem

Details for d2ciba_

PDB Entry: 2cib (more details), 1.5 Å

PDB Description: high throughput screening and x-ray crystallography assisted evaluation of small molecule scaffolds for cyp51 inhibitors
PDB Compounds: (A:) cytochrome p450 51

SCOPe Domain Sequences for d2ciba_:

Sequence, based on SEQRES records: (download)

>d2ciba_ a.104.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
alprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanefffr
agdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqvrrm
iadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdp
ylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprfsad
eitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqi
pqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphd
fvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppe
syrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d2ciba_ a.104.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
alprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanefffr
agdddldqakaypfmtpifglrgeqmkghaatiedqvrrmiadwgeageidlldffaelt
iytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesfrrrdearnglval
vadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfaghhtssgtaswtl
ielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhppliilmrvak
gefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedllnrwtwipfga
grhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaqpaavryrrrt

SCOPe Domain Coordinates for d2ciba_:

Click to download the PDB-style file with coordinates for d2ciba_.
(The format of our PDB-style files is described here.)

Timeline for d2ciba_: