Lineage for d2ci0a_ (2ci0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005494Species Mycobacterium tuberculosis [TaxId:83332] [187210] (6 PDB entries)
  8. 2005497Domain d2ci0a_: 2ci0 A: [146397]
    automated match to d1e9xa_
    complexed with 1cm, hem

Details for d2ci0a_

PDB Entry: 2ci0 (more details), 1.53 Å

PDB Description: high throughput screening and x-ray crystallography assisted evaluation of small molecule scaffolds for cyp51 inhibitors
PDB Compounds: (A:) cytochrome p450 51

SCOPe Domain Sequences for d2ci0a_:

Sequence, based on SEQRES records: (download)

>d2ci0a_ a.104.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
avalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshaneff
fragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqvr
rmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayv
dpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprfs
adeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalr
qipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdp
hdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqp
pesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d2ci0a_ a.104.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
avalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshaneff
fragdddldqakaypfmtpifglrgeqmkghaatiedqvrrmiadwgeageidlldffae
ltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesfrrrdearnglv
alvadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfaghhtssgtasw
tlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhppliilmrv
akgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedllnrwtwipf
gagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaqpaavryrr
rt

SCOPe Domain Coordinates for d2ci0a_:

Click to download the PDB-style file with coordinates for d2ci0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ci0a_: