Lineage for d2cfua2 (2cfu A:20-524)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876785Family d.157.1.13: Alkylsulfatase-like [160861] (1 protein)
    subfamily of Pfam PF00753; includes all-alpha linker subdomain
  6. 876786Protein Alkylsulfatase SdsA1 [160862] (1 species)
  7. 876787Species Pseudomonas aeruginosa [TaxId:287] [160863] (4 PDB entries)
    Uniprot Q9I5I9 20-524
  8. 876788Domain d2cfua2: 2cfu A:20-524 [146387]
    Other proteins in same PDB: d2cfua1
    complexed with 1db, ipa, peg, zn

Details for d2cfua2

PDB Entry: 2cfu (more details), 1.9 Å

PDB Description: crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with 1-decane-sulfonic-acid.
PDB Compounds: (A:) sdsa1

SCOP Domain Sequences for d2cfua2:

Sequence, based on SEQRES records: (download)

>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]}
ttapkppsaftveaqrrveaelpfadradferadrglirrperllirnpdgsvawqlggy
dflldgkprdsinpslqrqallnlkyglfevaegiyqvrgfdlanitfirgdsgwivvdt
lttpataraayelvsrelgerpirtviyshahadhfggvrglvepqqvasgavqiiapag
fmeaaikenvlagnammrratyqygtqlpkgpqgqvdmaigkglargplsllaptrlieg
egedlvldgvpftfqntpgtespaemniwlprqkallmaenvvgtlhnlytlrgaevrda
lgwskyinqalhrfgrqaevmfavhnwprwgnaeivevlekqrdlygylhdqtlhlanqg
vtigqvhnrlrlppsldqewydrgyhgsvshnaravlnrylgyydgnpatldplspedsa
gryveymggaerlleqarasyargeyrwvvevvnrlvfaepdnraarelqadaleqlgyq
aenagwrnsylsaayelrhgvprdq

Sequence, based on observed residues (ATOM records): (download)

>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]}
ttapkppsaftveaqrrveaelpfadradferadrglirrperllirnpdgsvawqlggy
dflldgkprdsinpslqrqallnlkyglfevaegiyqvrgfdlanitfirgdsgwivvdt
lttpataraayelvsrelgerpirtviyshahadhfggvrglvepqqvasgavqiiapag
fmeaaivlagnammrratyqygtqlpkgpqgqvdmaigkglargplsllaptrliegege
dlvldgvpftfqntpgtespaemniwlprqkallmaenvvgtlhnlytlrgaevrdalgw
skyinqalhrfgrqaevmfavhnwprwgnaeivevlekqrdlygylhdqtlhlanqgvti
gqvhnrlrlppsldqewydrgyhgsvshnaravlnrylgyydgnpatldplspedsagry
veymggaerlleqarasyargeyrwvvevvnrlvfaepdnraarelqadaleqlgyqaen
agwrnsylsaayelrhgvprdq

SCOP Domain Coordinates for d2cfua2:

Click to download the PDB-style file with coordinates for d2cfua2.
(The format of our PDB-style files is described here.)

Timeline for d2cfua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cfua1