Lineage for d2c9za_ (2c9z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142483Family c.87.1.10: UDPGT-like [159785] (5 protein domains)
    Pfam PF00201
  6. 2142501Protein automated matches [190473] (2 species)
    not a true protein
  7. 2142502Species Grape (Vitis vinifera) [TaxId:29760] [187507] (2 PDB entries)
  8. 2142504Domain d2c9za_: 2c9z A: [146383]
    automated match to d2c1xa1
    complexed with que, udp

Details for d2c9za_

PDB Entry: 2c9z (more details), 2.1 Å

PDB Description: structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification
PDB Compounds: (A:) udp glucose:flavonoid 3-o-glucosyltransferase

SCOPe Domain Sequences for d2c9za_:

Sequence, based on SEQRES records: (download)

>d2c9za_ c.87.1.10 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
tnphvavlafpfsthaapllavvrrlaaaaphavfsffstsqsnasifhdsmhtmqcnik
sydisdgvpegyvfagrpqedielftraapesfrqgmvmavaetgrpvsclvadafiwfa
admaaemgvawlpfwtagpnslsthvyideirekigvsgiqgredellnfipgmskvrfr
dlqegivfgnlnslfsrmlhrmgqvlpkatavfinsfeelddsltndlksklktylnigp
fnlitpppvvpnttgclqwlkerkptsvvyisfgtvttpppaevvalsealeasrvpfiw
slrdkarvhlpegflektrgygmvvpwapqaevlaheavgafvthcgwnslwesvaggvp
licrpffgdqrlngrmvedvleigvrieggvftksglmscfdqilsqekgkklrenlral
retadravgpkgsstenfitlvdlvskpkdv

Sequence, based on observed residues (ATOM records): (download)

>d2c9za_ c.87.1.10 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
tnphvavlafpfsthaapllavvrrlaaaaphavfsffstsqsnasifhtmqcniksydi
sdgvpegyvfagrpqedielftraapesfrqgmvmavaetgrpvsclvadafiwfaadma
aemgvawlpfwtagpnslsthvyideirekigvsgiqgredellnfipgmskvrfrdlqe
givfgnlnslfsrmlhrmgqvlpkatavfinsfeelddsltndlksklktylnigpfnli
tgclqwlkerkptsvvyisfgtvttpppaevvalsealeasrvpfiwslrdkarvhlpeg
flektrgygmvvpwapqaevlaheavgafvthcgwnslwesvaggvplicrpffgdqrln
grmvedvleigvrieggvftksglmscfdqilsqekgkklrenlralretadravgpkgs
stenfitlvdlvskpkdv

SCOPe Domain Coordinates for d2c9za_:

Click to download the PDB-style file with coordinates for d2c9za_.
(The format of our PDB-style files is described here.)

Timeline for d2c9za_: