Lineage for d2c3fa1 (2c3f A:7-336)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074990Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2074991Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2075029Family b.108.1.5: HylP-like [159317] (1 protein)
    Pfam PF07212
  6. 2075030Protein Phage-associated hyaluronidase, HylP1 [159318] (1 species)
  7. 2075031Species Streptococcus pyogenes [TaxId:1314] [159319] (7 PDB entries)
    Uniprot Q9A0M7 7-336! Uniprot Q9A0M7 7-337
  8. 2075032Domain d2c3fa1: 2c3f A:7-336 [146370]
    complexed with na

Details for d2c3fa1

PDB Entry: 2c3f (more details), 1.81 Å

PDB Description: the structure of a group a streptococcal phage-encoded tail-fibre showing hyaluronan lyase activity.
PDB Compounds: (A:) hyaluronidase, phage associated

SCOPe Domain Sequences for d2c3fa1:

Sequence, based on SEQRES records: (download)

>d2c3fa1 b.108.1.5 (A:7-336) Phage-associated hyaluronidase, HylP1 {Streptococcus pyogenes [TaxId: 1314]}
lrvqfkrmkaaewarsdvilleseigfetdtgfaragdghnrfsdlgyispldynlltnk
pnidglatkvetaqklqqkadketvytkaeskqeldkklnlkggvmtgqlkfkpaatvay
ssstggavnidlsstrgagvvvysdndtsdgplmslrtgketfnqsalfvdykgttnavn
iamrqpttpnfssalnitsgnengsamqlrgsekalgtlkithenpsigadydknaaals
idivkktngagtaaqgiyinstsgttgkllrirnlsddkfyvksdggfyaketsqidgnl
klkdptandhaatkayvdkaiselkklilk

Sequence, based on observed residues (ATOM records): (download)

>d2c3fa1 b.108.1.5 (A:7-336) Phage-associated hyaluronidase, HylP1 {Streptococcus pyogenes [TaxId: 1314]}
lrvqfkrmkaaewarsdvilleseigfetdtgfaragdghnrfsdlgyispldynlltnk
pnidglatkvetaqklqqkadketvytkaeskqeldkklnlkggvmtgqlkfkpatggav
nidlsstrgagvvvysdndtsdgplmslrtgketfnqsalfvdykgttnavniamrqptt
pnfssalnitsgnengsamqlrgsekalgtlkithenpsigadydknaaalsidivkktn
gagtaaqgiyinstsgttgkllrirnlsddkfyvksdggfyaketsqidgnlklkdptan
dhaatkayvdkaiselkklilk

SCOPe Domain Coordinates for d2c3fa1:

Click to download the PDB-style file with coordinates for d2c3fa1.
(The format of our PDB-style files is described here.)

Timeline for d2c3fa1: