Lineage for d2c39x1 (2c39 X:8-155)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401647Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1401648Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 1401656Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 1401708Domain d2c39x1: 2c39 X:8-155 [146368]
    Other proteins in same PDB: d2c39a1, d2c39a2, d2c39b2, d2c39c1, d2c39c2, d2c39d2, d2c39e1, d2c39e2, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j2, d2c39k1, d2c39k2, d2c39l2, d2c39m1, d2c39m2, d2c39n2, d2c39o1, d2c39o2, d2c39p2, d2c39q1, d2c39q2, d2c39r2, d2c39s1, d2c39s2, d2c39t2, d2c39u1, d2c39u2, d2c39v2, d2c39w1, d2c39w2, d2c39x2
    automatically matched to 2BR2 B:8-155
    protein/RNA complex; complexed with adp

Details for d2c39x1

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (X:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2c39x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c39x1 d.14.1.4 (X:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2c39x1:

Click to download the PDB-style file with coordinates for d2c39x1.
(The format of our PDB-style files is described here.)

Timeline for d2c39x1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39x2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39b1, d2c39b2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39s1, d2c39s2, d2c39t1, d2c39t2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2