SCOP 1.75: Domain d2c39v1: 2c39 V:9-155

Lineage for d2c39v1 (2c39 V:9-155)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)

6. Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries)
   Uniprot Q9UXC2 8-155

8. Domain d2c39v1: 2c39 V:9-155 [146364]
   Other proteins in same PDB: d2c39a1, d2c39a2, d2c39b2, d2c39c1, d2c39c2, d2c39d2, d2c39e1, d2c39e2, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j2, d2c39k1, d2c39k2, d2c39l2, d2c39m1, d2c39m2, d2c39n2, d2c39o1, d2c39o2, d2c39p2, d2c39q1, d2c39q2, d2c39r2, d2c39s1, d2c39s2, d2c39t2, d2c39u1, d2c39u2, d2c39v2, d2c39w1, d2c39w2, d2c39x2
   automatically matched to 2BR2 B:8-155
   complexed with adp

Details for d2c39v1

PDB Entry: 2c39, 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp

PDB Compounds: (V:) probable exosome complex exonuclease 1

SCOP Domain Sequences for d2c39v1:

Sequence; same for both SEQRES and ATOM records:

>d2c39v1 d.14.1.4 (V:9-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh
lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf
teilqadagsrlvslmaaslaladagi

Timeline for d2c39v1:

• d2c39v1 is new in SCOP 1.75
  
• d2c39v1 appears in SCOPe 2.01
  
• d2c39v1 appears in the current release, SCOPe 2.07