Lineage for d2c39r1 (2c39 R:8-155)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891941Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1891942Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 1891950Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 1891999Domain d2c39r1: 2c39 R:8-155 [146356]
    Other proteins in same PDB: d2c39a1, d2c39a2, d2c39b2, d2c39c1, d2c39c2, d2c39d2, d2c39e1, d2c39e2, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j2, d2c39k1, d2c39k2, d2c39l2, d2c39m1, d2c39m2, d2c39n2, d2c39o1, d2c39o2, d2c39p2, d2c39q1, d2c39q2, d2c39r2, d2c39s1, d2c39s2, d2c39t2, d2c39u1, d2c39u2, d2c39v2, d2c39w1, d2c39w2, d2c39x2
    automatically matched to 2BR2 B:8-155
    protein/RNA complex; complexed with adp

Details for d2c39r1

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (R:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2c39r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c39r1 d.14.1.4 (R:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2c39r1:

Click to download the PDB-style file with coordinates for d2c39r1.
(The format of our PDB-style files is described here.)

Timeline for d2c39r1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39r2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39b1, d2c39b2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39s1, d2c39s2, d2c39t1, d2c39t2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2