Lineage for d2c39b2 (2c39 B:156-248)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869404Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 869405Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 869406Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 869407Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 869415Species Sulfolobus solfataricus [TaxId:2287] [160591] (7 PDB entries)
    Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248
  8. 869455Domain d2c39b2: 2c39 B:156-248 [146327]
    Other proteins in same PDB: d2c39a1, d2c39a2, d2c39b1, d2c39c1, d2c39c2, d2c39d1, d2c39e1, d2c39e2, d2c39f1, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39k1, d2c39k2, d2c39l1, d2c39m1, d2c39m2, d2c39n1, d2c39o1, d2c39o2, d2c39p1, d2c39q1, d2c39q2, d2c39r1, d2c39s1, d2c39s2, d2c39t1, d2c39u1, d2c39u2, d2c39v1, d2c39w1, d2c39w2, d2c39x1
    automatically matched to 2BR2 B:156-248
    complexed with adp

Details for d2c39b2

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (B:) probable exosome complex exonuclease 1

SCOP Domain Sequences for d2c39b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c39b2 d.101.1.1 (B:156-248) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
pmrdliagvavgkadgviildlnetedmwgeadmpiammpslnqvtlfqlngsmtpdefr
qafdlavkginiiynlerealkskyvefkeegv

SCOP Domain Coordinates for d2c39b2:

Click to download the PDB-style file with coordinates for d2c39b2.
(The format of our PDB-style files is described here.)

Timeline for d2c39b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39s1, d2c39s2, d2c39t1, d2c39t2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2