Lineage for d2c38u1 (2c38 U:1-191)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853283Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 853291Species Sulfolobus solfataricus [TaxId:2287] [159922] (7 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 853329Domain d2c38u1: 2c38 U:1-191 [146316]
    Other proteins in same PDB: d2c38a2, d2c38b1, d2c38b2, d2c38c2, d2c38d1, d2c38d2, d2c38e2, d2c38f1, d2c38f2, d2c38g2, d2c38h1, d2c38h2, d2c38i2, d2c38j1, d2c38j2, d2c38k2, d2c38l1, d2c38l2, d2c38m2, d2c38n1, d2c38n2, d2c38o2, d2c38p1, d2c38p2, d2c38q2, d2c38r1, d2c38r2, d2c38s2, d2c38t1, d2c38t2, d2c38u2, d2c38v1, d2c38v2, d2c38w2, d2c38x1, d2c38x2
    automatically matched to 2JE6 A:1-191
    complexed with amp, cl

Details for d2c38u1

PDB Entry: 2c38 (more details), 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna
PDB Compounds: (U:) probable exosome complex exonuclease 2

SCOP Domain Sequences for d2c38u1:

Sequence, based on SEQRES records: (download)

>d2c38u1 d.14.1.4 (U:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2c38u1 d.14.1.4 (U:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
nevvgkl

SCOP Domain Coordinates for d2c38u1:

Click to download the PDB-style file with coordinates for d2c38u1.
(The format of our PDB-style files is described here.)

Timeline for d2c38u1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c38u2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2