Lineage for d2c38r1 (2c38 R:8-155)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853224Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 853232Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 853268Domain d2c38r1: 2c38 R:8-155 [146310]
    Other proteins in same PDB: d2c38a1, d2c38a2, d2c38b2, d2c38c1, d2c38c2, d2c38d2, d2c38e1, d2c38e2, d2c38f2, d2c38g1, d2c38g2, d2c38h2, d2c38i1, d2c38i2, d2c38j2, d2c38k1, d2c38k2, d2c38l2, d2c38m1, d2c38m2, d2c38n2, d2c38o1, d2c38o2, d2c38p2, d2c38q1, d2c38q2, d2c38r2, d2c38s1, d2c38s2, d2c38t2, d2c38u1, d2c38u2, d2c38v2, d2c38w1, d2c38w2, d2c38x2
    automatically matched to 2BR2 B:8-155
    complexed with amp, cl

Details for d2c38r1

PDB Entry: 2c38 (more details), 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna
PDB Compounds: (R:) probable exosome complex exonuclease 1

SCOP Domain Sequences for d2c38r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c38r1 d.14.1.4 (R:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOP Domain Coordinates for d2c38r1:

Click to download the PDB-style file with coordinates for d2c38r1.
(The format of our PDB-style files is described here.)

Timeline for d2c38r1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c38r2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2