Lineage for d2c38q2 (2c38 Q:192-275)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036591Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1036592Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 1036593Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 1036653Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 1036661Species Sulfolobus solfataricus [TaxId:2287] [160599] (7 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 1036697Domain d2c38q2: 2c38 Q:192-275 [146309]
    Other proteins in same PDB: d2c38a1, d2c38b1, d2c38b2, d2c38c1, d2c38d1, d2c38d2, d2c38e1, d2c38f1, d2c38f2, d2c38g1, d2c38h1, d2c38h2, d2c38i1, d2c38j1, d2c38j2, d2c38k1, d2c38l1, d2c38l2, d2c38m1, d2c38n1, d2c38n2, d2c38o1, d2c38p1, d2c38p2, d2c38q1, d2c38r1, d2c38r2, d2c38s1, d2c38t1, d2c38t2, d2c38u1, d2c38v1, d2c38v2, d2c38w1, d2c38x1, d2c38x2
    automatically matched to 2JE6 A:192-275
    protein/RNA complex; complexed with amp, cl

Details for d2c38q2

PDB Entry: 2c38 (more details), 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna
PDB Compounds: (Q:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c38q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c38q2 d.101.1.1 (Q:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2c38q2:

Click to download the PDB-style file with coordinates for d2c38q2.
(The format of our PDB-style files is described here.)

Timeline for d2c38q2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c38q1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2