Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
Protein automated matches [232811] (2 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [232812] (4 PDB entries) |
Domain d2c38k1: 2c38 K:1-191 [146296] Other proteins in same PDB: d2c38a2, d2c38b1, d2c38b2, d2c38c2, d2c38d1, d2c38d2, d2c38e2, d2c38f1, d2c38f2, d2c38g2, d2c38h1, d2c38h2, d2c38i2, d2c38j1, d2c38j2, d2c38k2, d2c38l1, d2c38l2, d2c38m2, d2c38n1, d2c38n2, d2c38o2, d2c38p1, d2c38p2, d2c38q2, d2c38r1, d2c38r2, d2c38s2, d2c38t1, d2c38t2, d2c38u2, d2c38v1, d2c38v2, d2c38w2, d2c38x1, d2c38x2 automated match to d2je6a1 protein/RNA complex; complexed with amp, cl |
PDB Entry: 2c38 (more details), 3.1 Å
SCOPe Domain Sequences for d2c38k1:
Sequence, based on SEQRES records: (download)
>d2c38k1 d.14.1.4 (K:1-191) automated matches {Sulfolobus solfataricus [TaxId: 2287]} msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi svnknevvgkl
>d2c38k1 d.14.1.4 (K:1-191) automated matches {Sulfolobus solfataricus [TaxId: 2287]} msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk nevvgkl
Timeline for d2c38k1:
View in 3D Domains from other chains: (mouse over for more information) d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2 |