Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries) Uniprot Q9UXC2 8-155 |
Domain d2c38h1: 2c38 H:8-155 [146290] Other proteins in same PDB: d2c38a1, d2c38a2, d2c38b2, d2c38c1, d2c38c2, d2c38d2, d2c38e1, d2c38e2, d2c38f2, d2c38g1, d2c38g2, d2c38h2, d2c38i1, d2c38i2, d2c38j2, d2c38k1, d2c38k2, d2c38l2, d2c38m1, d2c38m2, d2c38n2, d2c38o1, d2c38o2, d2c38p2, d2c38q1, d2c38q2, d2c38r2, d2c38s1, d2c38s2, d2c38t2, d2c38u1, d2c38u2, d2c38v2, d2c38w1, d2c38w2, d2c38x2 automatically matched to 2BR2 B:8-155 protein/RNA complex; complexed with amp, cl |
PDB Entry: 2c38 (more details), 3.1 Å
SCOPe Domain Sequences for d2c38h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c38h1 d.14.1.4 (H:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv fteilqadagsrlvslmaaslaladagi
Timeline for d2c38h1:
View in 3D Domains from other chains: (mouse over for more information) d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2 |