Lineage for d2c38c2 (2c38 C:192-275)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869404Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 869405Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 869406Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 869466Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 869474Species Sulfolobus solfataricus [TaxId:2287] [160599] (7 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 869503Domain d2c38c2: 2c38 C:192-275 [146281]
    Other proteins in same PDB: d2c38a1, d2c38b1, d2c38b2, d2c38c1, d2c38d1, d2c38d2, d2c38e1, d2c38f1, d2c38f2, d2c38g1, d2c38h1, d2c38h2, d2c38i1, d2c38j1, d2c38j2, d2c38k1, d2c38l1, d2c38l2, d2c38m1, d2c38n1, d2c38n2, d2c38o1, d2c38p1, d2c38p2, d2c38q1, d2c38r1, d2c38r2, d2c38s1, d2c38t1, d2c38t2, d2c38u1, d2c38v1, d2c38v2, d2c38w1, d2c38x1, d2c38x2
    automatically matched to 2JE6 A:192-275
    complexed with amp, cl

Details for d2c38c2

PDB Entry: 2c38 (more details), 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna
PDB Compounds: (C:) probable exosome complex exonuclease 2

SCOP Domain Sequences for d2c38c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c38c2 d.101.1.1 (C:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOP Domain Coordinates for d2c38c2:

Click to download the PDB-style file with coordinates for d2c38c2.
(The format of our PDB-style files is described here.)

Timeline for d2c38c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c38c1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2