Lineage for d2c37k2 (2c37 K:192-275)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208270Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2208271Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2208423Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 2208424Protein automated matches [226956] (5 species)
    not a true protein
  7. 2208450Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)
  8. 2208471Domain d2c37k2: 2c37 K:192-275 [146249]
    Other proteins in same PDB: d2c37a1, d2c37b1, d2c37b2, d2c37c1, d2c37d1, d2c37d2, d2c37e1, d2c37f1, d2c37f2, d2c37g1, d2c37h1, d2c37h2, d2c37i1, d2c37j1, d2c37j2, d2c37k1, d2c37l1, d2c37l2, d2c37m1, d2c37n1, d2c37n2, d2c37o1, d2c37p1, d2c37p2, d2c37q1, d2c37r1, d2c37r2, d2c37s1, d2c37t1, d2c37t2, d2c37u1, d2c37v1, d2c37v2, d2c37w1, d2c37x1, d2c37x2
    automated match to d2je6a2
    protein/RNA complex; complexed with cl, na, rp5, u5p

Details for d2c37k2

PDB Entry: 2c37 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome in complex with u8 rna
PDB Compounds: (K:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c37k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c37k2 d.101.1.0 (K:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2c37k2:

Click to download the PDB-style file with coordinates for d2c37k2.
(The format of our PDB-style files is described here.)

Timeline for d2c37k2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c37k1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c37a1, d2c37a2, d2c37b1, d2c37b2, d2c37c1, d2c37c2, d2c37d1, d2c37d2, d2c37e1, d2c37e2, d2c37f1, d2c37f2, d2c37g1, d2c37g2, d2c37h1, d2c37h2, d2c37i1, d2c37i2, d2c37j1, d2c37j2, d2c37l1, d2c37l2, d2c37m1, d2c37m2, d2c37n1, d2c37n2, d2c37o1, d2c37o2, d2c37p1, d2c37p2, d2c37q1, d2c37q2, d2c37r1, d2c37r2, d2c37s1, d2c37s2, d2c37t1, d2c37t2, d2c37u1, d2c37u2, d2c37v1, d2c37v2, d2c37w1, d2c37w2, d2c37x1, d2c37x2