Lineage for d2c37e1 (2c37 E:1-191)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016991Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1016992Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1017230Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 1017290Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 1017298Species Sulfolobus solfataricus [TaxId:2287] [159922] (7 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 1017316Domain d2c37e1: 2c37 E:1-191 [146236]
    Other proteins in same PDB: d2c37a2, d2c37b1, d2c37b2, d2c37c2, d2c37d1, d2c37d2, d2c37e2, d2c37f1, d2c37f2, d2c37g2, d2c37h1, d2c37h2, d2c37i2, d2c37j1, d2c37j2, d2c37k2, d2c37l1, d2c37l2, d2c37m2, d2c37n1, d2c37n2, d2c37o2, d2c37p1, d2c37p2, d2c37q2, d2c37r1, d2c37r2, d2c37s2, d2c37t1, d2c37t2, d2c37u2, d2c37v1, d2c37v2, d2c37w2, d2c37x1, d2c37x2
    automatically matched to 2JE6 A:1-191
    protein/RNA complex; complexed with cl, na, rp5, u5p

Details for d2c37e1

PDB Entry: 2c37 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome in complex with u8 rna
PDB Compounds: (E:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c37e1:

Sequence, based on SEQRES records: (download)

>d2c37e1 d.14.1.4 (E:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2c37e1 d.14.1.4 (E:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgkl

SCOPe Domain Coordinates for d2c37e1:

Click to download the PDB-style file with coordinates for d2c37e1.
(The format of our PDB-style files is described here.)

Timeline for d2c37e1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c37e2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c37a1, d2c37a2, d2c37b1, d2c37b2, d2c37c1, d2c37c2, d2c37d1, d2c37d2, d2c37f1, d2c37f2, d2c37g1, d2c37g2, d2c37h1, d2c37h2, d2c37i1, d2c37i2, d2c37j1, d2c37j2, d2c37k1, d2c37k2, d2c37l1, d2c37l2, d2c37m1, d2c37m2, d2c37n1, d2c37n2, d2c37o1, d2c37o2, d2c37p1, d2c37p2, d2c37q1, d2c37q2, d2c37r1, d2c37r2, d2c37s1, d2c37s2, d2c37t1, d2c37t2, d2c37u1, d2c37u2, d2c37v1, d2c37v2, d2c37w1, d2c37w2, d2c37x1, d2c37x2