Lineage for d2c37b1 (2c37 B:8-155)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176588Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2176589Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 2176597Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 2176615Domain d2c37b1: 2c37 B:8-155 [146230]
    Other proteins in same PDB: d2c37a1, d2c37a2, d2c37b2, d2c37c1, d2c37c2, d2c37d2, d2c37e1, d2c37e2, d2c37f2, d2c37g1, d2c37g2, d2c37h2, d2c37i1, d2c37i2, d2c37j2, d2c37k1, d2c37k2, d2c37l2, d2c37m1, d2c37m2, d2c37n2, d2c37o1, d2c37o2, d2c37p2, d2c37q1, d2c37q2, d2c37r2, d2c37s1, d2c37s2, d2c37t2, d2c37u1, d2c37u2, d2c37v2, d2c37w1, d2c37w2, d2c37x2
    automated match to d2br2b1
    protein/RNA complex; complexed with cl, na, rp5, u5p

Details for d2c37b1

PDB Entry: 2c37 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome in complex with u8 rna
PDB Compounds: (B:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2c37b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c37b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2c37b1:

Click to download the PDB-style file with coordinates for d2c37b1.
(The format of our PDB-style files is described here.)

Timeline for d2c37b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c37b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c37a1, d2c37a2, d2c37c1, d2c37c2, d2c37d1, d2c37d2, d2c37e1, d2c37e2, d2c37f1, d2c37f2, d2c37g1, d2c37g2, d2c37h1, d2c37h2, d2c37i1, d2c37i2, d2c37j1, d2c37j2, d2c37k1, d2c37k2, d2c37l1, d2c37l2, d2c37m1, d2c37m2, d2c37n1, d2c37n2, d2c37o1, d2c37o2, d2c37p1, d2c37p2, d2c37q1, d2c37q2, d2c37r1, d2c37r2, d2c37s1, d2c37s2, d2c37t1, d2c37t2, d2c37u1, d2c37u2, d2c37v1, d2c37v2, d2c37w1, d2c37w2, d2c37x1, d2c37x2