Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
Protein Aquaporin-0 [103468] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [118226] (2 PDB entries) Uniprot P06624 |
Domain d2c32a1: 2c32 A:6-239 [146227] automatically matched to 1YMG A:6-239 |
PDB Entry: 2c32 (more details), 7.01 Å
SCOPe Domain Sequences for d2c32a1:
Sequence, based on SEQRES records: (download)
>d2c32a1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavghisga hvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgv svgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnp arsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
>d2c32a1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
Timeline for d2c32a1: