SCOPe 2.08: Domain d2c32a1: 2c32 A:6-239

Lineage for d2c32a1 (2c32 A:6-239)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (2 families)

5. Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
   duplication: consist of two similar structural parts
   automatically mapped to Pfam PF00230

6. Protein Aquaporin-0 [103468] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [118226] (2 PDB entries)
   Uniprot P06624

8. Domain d2c32a1: 2c32 A:6-239 [146227]
   automatically matched to 1YMG A:6-239

Details for d2c32a1

PDB Entry: 2c32, 7.01 Å

PDB Description: co-axial association of recombinant eye lens aquaporin-0 observed in loosely packed 3d-crystals

PDB Compounds: (A:) lens fiber major intrinsic protein

SCOPe Domain Sequences for d2c32a1:

Sequence, based on SEQRES records:

>d2c32a1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]}
sasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavghisga
hvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgv
svgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnp
arsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg

Sequence, based on observed residues (ATOM records):

>d2c32a1 f.19.1.1 (A:6-239) Aquaporin-0 {Cow (Bos taurus) [TaxId: 9913]}
sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah
vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs
vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa
rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg

Timeline for d2c32a1:

• d2c32a1 first appeared in SCOP 1.75
  
• d2c32a1 appears in SCOPe 2.07