Lineage for d2c1xa1 (2c1x A:7-456)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142483Family c.87.1.10: UDPGT-like [159785] (5 protein domains)
    Pfam PF00201
  6. 2142498Protein UDP glucose:flavonoid 3-o-glucosyltransferase [159786] (1 species)
  7. 2142499Species Grape (Vitis vinifera) [TaxId:29760] [159787] (1 PDB entry)
    Uniprot O22304 7-456
  8. 2142500Domain d2c1xa1: 2c1x A:7-456 [146225]
    complexed with b3p, udp

Details for d2c1xa1

PDB Entry: 2c1x (more details), 1.9 Å

PDB Description: structure and activity of a flavonoid 3-o glucosyltransferase reveals the basis for plant natural product modification
PDB Compounds: (A:) udp-glucose flavonoid 3-o glycosyltransferase

SCOPe Domain Sequences for d2c1xa1:

Sequence, based on SEQRES records: (download)

>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]}
nphvavlafpfsthaapllavvrrlaaaaphavfsffstsqsnasifhdsmhtmqcniks
ydisdgvpegyvfagrpqedielftraapesfrqgmvmavaetgrpvsclvadafiwfaa
dmaaemgvawlpfwtagpnslsthvyideirekigvsgiqgredellnfipgmskvrfrd
lqegivfgnlnslfsrmlhrmgqvlpkatavfinsfeelddsltndlksklktylnigpf
nlitpppvvpnttgclqwlkerkptsvvyisfgtvttpppaevvalsealeasrvpfiws
lrdkarvhlpegflektrgygmvvpwapqaevlaheavgafvthcgwnslwesvaggvpl
icrpffgdqrlngrmvedvleigvrieggvftksglmscfdqilsqekgkklrenlralr
etadravgpkgsstenfitlvdlvskpkdv

Sequence, based on observed residues (ATOM records): (download)

>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]}
nphvavlafpfsthaapllavvrrlaaaaphavfsffstsqsnasifqcniksydisdgv
pegyvfagrpqedielftraapesfrqgmvmavaetgrpvsclvadafiwfaadmaaemg
vawlpfwtagpnslsthvyideirekigvsgiqgredellnfipgmskvrfrdlqegivf
gnlnslfsrmlhrmgqvlpkatavfinsfeelddsltndlksklktylnigpfnlitgcl
qwlkerkptsvvyisfgtvttpppaevvalsealeasrvpfiwslrdkarvhlpegflek
trgygmvvpwapqaevlaheavgafvthcgwnslwesvaggvplicrpffgdqrlngrmv
edvleigvrieggvftksglmscfdqilsqekgkklrenlralretadravgpkgssten
fitlvdlvskpkdv

SCOPe Domain Coordinates for d2c1xa1:

Click to download the PDB-style file with coordinates for d2c1xa1.
(The format of our PDB-style files is described here.)

Timeline for d2c1xa1: