Lineage for d2bzea1 (2bze A:345-476)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797346Superfamily b.34.21: Plus3-like [159042] (1 family) (S)
  5. 797347Family b.34.21.1: Plus3 [159043] (1 protein)
    Pfam PF03126
  6. 797348Protein RNA polymerase-associated protein RTF1 homolog [159044] (1 species)
  7. 797349Species Human (Homo sapiens) [TaxId:9606] [159045] (2 PDB entries)
    Uniprot Q92541 307-442! Uniprot Q92541 313-444
  8. 797350Domain d2bzea1: 2bze A:345-476 [146224]

Details for d2bzea1

PDB Entry: 2bze (more details)

PDB Description: nmr structure of human rtf1 plus3 domain.
PDB Compounds: (A:) kiaa0252 protein

SCOP Domain Sequences for d2bzea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzea1 b.34.21.1 (A:345-476) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]}
vslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvveta
kvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldei
nkkelsikealn

SCOP Domain Coordinates for d2bzea1:

Click to download the PDB-style file with coordinates for d2bzea1.
(The format of our PDB-style files is described here.)

Timeline for d2bzea1: