Lineage for d2bxjb1 (2bxj B:1-99)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (4 species) 
Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
Uniprot P23370
Domain d2bxjb1: 2bxj B:1-99 [146223]
automatically matched to 2BXJ A:1-99
mutant
Details for d2bxjb1
PDB Entry: 2bxj (more details), 2.4 Å
PDB Description: double mutant of the ribosomal protein s6
PDB Compounds: (B:) 30S ribosomal protein S6SCOPe Domain Sequences for d2bxjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxjb1 d.58.14.1 (B:1-99) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqraaenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndaarelrirdnvrrvmvvksqepfla
SCOPe Domain Coordinates for d2bxjb1:
Click to download the PDB-style file with coordinates for d2bxjb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bxjb1:
- d2bxjb1 first appeared in SCOP 1.75
- d2bxjb1 appears in SCOPe 2.07
View in 3D
