Lineage for d2bxjb1 (2bxj B:1-99)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953643Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2953644Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2953645Protein Ribosomal protein S6 [54997] (4 species)
  7. 2953675Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2953679Domain d2bxjb1: 2bxj B:1-99 [146223]
    automatically matched to 2BXJ A:1-99
    mutant

Details for d2bxjb1

PDB Entry: 2bxj (more details), 2.4 Å

PDB Description: double mutant of the ribosomal protein s6
PDB Compounds: (B:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2bxjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxjb1 d.58.14.1 (B:1-99) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqraaenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndaarelrirdnvrrvmvvksqepfla

SCOPe Domain Coordinates for d2bxjb1:

Click to download the PDB-style file with coordinates for d2bxjb1.
(The format of our PDB-style files is described here.)

Timeline for d2bxjb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bxja1