Lineage for d2bvma_ (2bvm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133931Family c.68.1.22: Glycosylating toxin catalytic domain-like [159726] (4 protein domains)
    contains Glycosyltransferase sugar-binding region containing DXD motif, Pfam PF04488
  6. 2133942Protein automated matches [190532] (3 species)
    not a true protein
  7. 2133943Species Clostridium difficile [TaxId:1496] [187493] (1 PDB entry)
  8. 2133944Domain d2bvma_: 2bvm A: [146220]
    automated match to d2bvla1
    complexed with glc, mn, so4, udp

Details for d2bvma_

PDB Entry: 2bvm (more details), 2.55 Å

PDB Description: crystal structure of the catalytic domain of toxin b from clostridium difficile in complex with udp, glc and manganese ion
PDB Compounds: (A:) toxin b

SCOPe Domain Sequences for d2bvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvma_ c.68.1.22 (A:) automated matches {Clostridium difficile [TaxId: 1496]}
mslvnrkqlekmanvrfrtqedeyvaildaleeyhnmsentvvekylklkdinsltdici
dtykksgrnkalkkfkeylvtevlelknnnltpveknlhfvwiggqindtainyinqwkd
vnsdynvnvfydsnaflintlkktvvesaindtlesfrenlndprfdynkffrkrmeiiy
dkqknfinyykaqreenpeliiddivktylsneyskeidelntyieeslnkitqnsgndv
rnfgefkngesfnlyeqelverwnlaaasdilrisalkeiggmyldvdmlpgiqpdlfes
iekpssvtvdfwemtkleaimkykeyipeytsehfdmldeevqssfesvlasksdkseif
sslgdmeasplevkiafnskgiinqglisvkdsycsnlivkqienrykilnnslnpaise
dndfntttntfidsimaeanadngrfmmelgkylrvgffpdvkttinlsgpeayaaayqd
llmfkegsmnihlieadlrnfeisktnisqsteqemaslwsfddarakaqfeeykrnyfe
ga

SCOPe Domain Coordinates for d2bvma_:

Click to download the PDB-style file with coordinates for d2bvma_.
(The format of our PDB-style files is described here.)

Timeline for d2bvma_: