Lineage for d2bvla1 (2bvl A:1-542)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133931Family c.68.1.22: Glycosylating toxin catalytic domain-like [159726] (4 protein domains)
    contains Glycosyltransferase sugar-binding region containing DXD motif, Pfam PF04488
  6. 2133939Protein Toxin B [159731] (1 species)
  7. 2133940Species Clostridium difficile [TaxId:1496] [159732] (1 PDB entry)
    Uniprot P18177 1-542
  8. 2133941Domain d2bvla1: 2bvl A:1-542 [146219]
    complexed with glc, mn, so4, tbr, udp

Details for d2bvla1

PDB Entry: 2bvl (more details), 2.2 Å

PDB Description: crystal structure of the catalytic domain of toxin b from clostridium difficile in complex with udp, glc and manganese ion
PDB Compounds: (A:) toxin b

SCOPe Domain Sequences for d2bvla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvla1 c.68.1.22 (A:1-542) Toxin B {Clostridium difficile [TaxId: 1496]}
mslvnrkqlekmanvrfrtqedeyvaildaleeyhnmsentvvekylklkdinsltdici
dtykksgrnkalkkfkeylvtevlelknnnltpveknlhfvwiggqindtainyinqwkd
vnsdynvnvfydsnaflintlkktvvesaindtlesfrenlndprfdynkffrkrmeiiy
dkqknfinyykaqreenpeliiddivktylsneyskeidelntyieeslnkitqnsgndv
rnfgefkngesfnlyeqelverwnlaaasdilrisalkeiggmyldvdmlpgiqpdlfes
iekpssvtvdfwemtkleaimkykeyipeytsehfdmldeevqssfesvlasksdkseif
sslgdmeasplevkiafnskgiinqglisvkdsycsnlivkqienrykilnnslnpaise
dndfntttntfidsimaeanadngrfmmelgkylrvgffpdvkttinlsgpeayaaayqd
llmfkegsmnihlieadlrnfeisktnisqsteqemaslwsfddarakaqfeeykrnyfe
ga

SCOPe Domain Coordinates for d2bvla1:

Click to download the PDB-style file with coordinates for d2bvla1.
(The format of our PDB-style files is described here.)

Timeline for d2bvla1: