| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
| Protein Transcriptional regulator MgrA [158272] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [158273] (1 PDB entry) Uniprot Q7A1J9 6-141 |
| Domain d2bv6a1: 2bv6 A:6-140 [146218] Other proteins in same PDB: d2bv6a2 complexed with so4 |
PDB Entry: 2bv6 (more details), 2.8 Å
SCOPe Domain Sequences for d2bv6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv6a1 a.4.5.28 (A:6-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]}
nlkeqlcfslynaqrqvnryysnkvfkkynltypqflvltilwdespvnvkkvvtelald
tgtvspllkrmeqvdlikrersevdqrevfihltdksetirpelsnasdkvasasslsqd
evkelnrllgkviha
Timeline for d2bv6a1: