SCOPe 2.04: Domain d2brjc_: 2brj C:

Lineage for d2brjc_ (2brj C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
   Pfam PF06351

6. Protein automated matches [190385] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187238] (1 PDB entry)

8. Domain d2brjc_: 2brj C: [146215]
   Other proteins in same PDB: d2brja1
   automated match to d1z8ka1
   complexed with gol

Details for d2brjc_

PDB Entry: 2brj, 1.5 Å

PDB Description: x-ray structure of the allene oxide cyclase from arabidopsis thaliana

PDB Compounds: (C:) arabidopsis thaliana genomic DNA, chromosome 3,

SCOPe Domain Sequences for d2brjc_:

Sequence; same for both SEQRES and ATOM records:

>d2brjc_ b.159.1.1 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

Timeline for d2brjc_:

• d2brjc_ first appeared in SCOP 1.75, called d2brjc1
  
• d2brjc_ appears in SCOPe 2.03
  
• d2brjc_ appears in SCOPe 2.05
  
• d2brjc_ appears in the current release, SCOPe 2.08