SCOP 1.75: Domain d2brjc1: 2brj C:15-188

Lineage for d2brjc1 (2brj C:15-188)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (1 family)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (1 protein)
   Pfam PF06351

6. Protein Allene oxide cyclase, AOC [141495] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
   Uniprot Q9LS02 80-253

8. Domain d2brjc1: 2brj C:15-188 [146215]
   automatically matched to 2BRJ A:15-188
   complexed with gol

Details for d2brjc1

PDB Entry: 2brj, 1.5 Å

PDB Description: x-ray structure of the allene oxide cyclase from arabidopsis thaliana

PDB Compounds: (C:) arabidopsis thaliana genomic DNA, chromosome 3, tac clone:k13n2

SCOP Domain Sequences for d2brjc1:

Sequence; same for both SEQRES and ATOM records:

>d2brjc1 b.159.1.1 (C:15-188) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

Timeline for d2brjc1:

• d2brjc1 is new in SCOP 1.75
  
• d2brjc1 is called d2brjc_ in SCOPe 2.01
  
• d2brjc1 appears in the current release, SCOPe 2.08, called d2brjc_