Lineage for d2brja1 (2brj A:15-188)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813942Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 813943Superfamily b.159.1: Allene oxide cyclase-like [141493] (1 family) (S)
  5. 813944Family b.159.1.1: Allene oxide cyclase-like [141494] (1 protein)
    Pfam PF06351
  6. 813945Protein Allene oxide cyclase, AOC [141495] (2 species)
  7. 813948Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
    Uniprot Q9LS02 80-253
  8. 813949Domain d2brja1: 2brj A:15-188 [146213]
    complexed with gol

Details for d2brja1

PDB Entry: 2brj (more details), 1.5 Å

PDB Description: x-ray structure of the allene oxide cyclase from arabidopsis thaliana
PDB Compounds: (A:) arabidopsis thaliana genomic DNA, chromosome 3, tac clone:k13n2

SCOP Domain Sequences for d2brja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brja1 b.159.1.1 (A:15-188) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

SCOP Domain Coordinates for d2brja1:

Click to download the PDB-style file with coordinates for d2brja1.
(The format of our PDB-style files is described here.)

Timeline for d2brja1: